PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA05G16770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 839aa    MW: 91891.3 Da    PI: 6.1924
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA05G16770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP111.74.4e-35168242276
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                      Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  ONIVA05G16770.1 168 CQVPGCEADIRELKGYHRRHRVCLRCAHATAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 242
                      ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.9E-27162229IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.504165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-33166245IPR004333Transcription factor, SBP-box
PfamPF031106.1E-27168242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MDAPGGGGGG GGGVDAGEPV WDWGNLLDFA VHDDDSLVLP WGDDSIGIEA DPAEAALLPP  60
APSPQPAEAE AEAAGPASLP SSMQAEGSKR RVRKRDPRLV CPNYLAGRVP CACPEIDEMA  120
AALEVEDVAT ELLAGARKKP KGAGRGSGAA VGGSGGGASR GTPAEMKCQV PGCEADIREL  180
KGYHRRHRVC LRCAHATAVM LDGVQKRYCQ QCGKFHILLD FDEDKRSCRR KLERHNKRRR  240
RKPDSKGILE KDIDDQLDFS ADGSGDGELR EENIDVTTSE TLETVLSNKV LDRETPVGSD  300
DVLSSPTCAQ PSLQIDQSKS LVTFAASVEA CLGTKQENTK LTNSPVHDTK STYSSSCPTG  360
RVSFKLYDWN PAEFPRRLRH QIFEWLSSMP VELEGYIRPG CTILTVFVAM PQHMWDKLSE  420
DTGNLVKSLV NAPNSLLLGK GAFFIHVNNM IFQVLKDGAT LTSTRLEVQS PRIHYVHPSW  480
FEAGKPIDLI LCGSSLDQPK FRSLVSFDGL YLKHDCRRIL SHETFDCIGS GEHILDSQHE  540
IFRINITTSK LDTHGPAFVE VENMFGLSNF VPILVGSKHL CSELEQIHDA LCGSSDISSD  600
PCELRGLRQT AMLGFLIDIG WLIRKPSIDE FQNLLSLANI QRWICMMKFL IQNDFINVLE  660
IIVNSLDNII GSELLSNLEK GRLENHVTEF LGYVSEARNI VDNRPKYDKQ RQVDTRWAGD  720
YAPNQPKLGI SVPLAESTGT SGEHDLHTTN AASGEEENMP LVTKALPHRQ CCHPETSARW  780
LNAASIGAFP GGAMRMRLAT TVVIGAVVCF AACVVLFHPH RVGVLAAPVK RYLSRNYSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-37167247585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224242KRSCRRKLERHNKRRRRKP
2228240RRKLERHNKRRRR
3235242NKRRRRKP
4236241KRRRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000570.0AK100057.1 Oryza sativa Japonica Group cDNA clone:J013158B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640052.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A0E0HEC00.0A0A0E0HEC0_ORYNI; Uncharacterized protein
STRINGLOC_Os05g33810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-144squamosa promoter binding protein-like 7